PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 506aa    MW: 57944.7 Da    PI: 5.3084
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00317genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.5e-142661896
                 --HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3 18 lpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                 +p +f+++++       ++ l++  s r W+v+l      + yvlt+GW+eFv a++Lk+gD +vFk+d+++ f  +v+v
  AA102G00317  2 VPDEFVRKYK-------KVWLRSdHSDRNWRVRL------EDYVLTDGWEEFVAAHNLKDGDNLVFKHDRDEFF--HVSV 66
                 6888888886.......3566663777*******......88*************************9987777..6665 PP

2B364.91.2e-20134226599
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   ++ ++l ++r+ l ++f+  ++g++ + +++ +++e+gr+W++ l  +k+ g +++++GWk+F+ angL egD + Fkl++ +++++v+ +++k
  AA102G00317 134 RVSRYTLLHDRVDLGREFTLLYNGDN-KRREIDVKNEQGRRWTMVLLLNKTTGVFYIKRGWKSFCCANGLSEGDLCKFKLVE-NGENPVLLLCSK 226
                  5678889999********99995553.4469***************99********************************98.777799999987 PP

3B371.21.4e-22277378199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelv 93 
                  f++ + +++ ++sg+l+lp+ f++e+g kk++  ++tl +++gr+We +l++    +++s++++l++GW+e++kan++ + D+++++l+++  ++++v
  AA102G00317 277 FVTLEYTPNRHTSGQLSLPRCFTRENGFKKPG--EITLLNKDGRKWEAYLQMagckDNGSEWFYLRRGWREMCKANEVMVHDSFMLELIWDdANATPV 372
                  6778889999****************999766..8***************999999999999***************************999****** PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  +k+++k
  AA102G00317 373 LKFCSK 378
                  ***987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100173.56E-15166No hitNo description
SMARTSM010196.5E-7170IPR003340B3 DNA binding domain
PROSITE profilePS5086313.14170IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-13266IPR015300DNA-binding pseudobarrel domain
PfamPF023628.8E-11264IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-14366IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.958130226IPR003340B3 DNA binding domain
CDDcd100171.54E-16131225No hitNo description
SMARTSM010191.2E-22131227IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-17131226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-19132231IPR015300DNA-binding pseudobarrel domain
PfamPF023623.4E-19133226IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-16276378IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.549277378IPR003340B3 DNA binding domain
SMARTSM010196.1E-22277379IPR003340B3 DNA binding domain
PfamPF023621.0E-22277378IPR003340B3 DNA binding domain
SuperFamilySSF1019367.26E-17282381IPR015300DNA-binding pseudobarrel domain
CDDcd100172.28E-15285366No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
TVPDEFVRKY KKVWLRSDHS DRNWRVRLED YVLTDGWEEF VAAHNLKDGD NLVFKHDRDE  60
FFHVSVEPRS DTVDAQNDYG DISEEFTVDN GADVDVDVVN HSDGKESEDE GDEGNISEKK  120
DQNPEVNSSP FVVRVSRYTL LHDRVDLGRE FTLLYNGDNK RREIDVKNEQ GRRWTMVLLL  180
NKTTGVFYIK RGWKSFCCAN GLSEGDLCKF KLVENGENPV LLLCSKESAI NQSSSQEDGE  240
EEEECPDAEA AVKGCKEEKS MSDEGLKGKE KKIPSRFVTL EYTPNRHTSG QLSLPRCFTR  300
ENGFKKPGEI TLLNKDGRKW EAYLQMAGCK DNGSEWFYLR RGWREMCKAN EVMVHDSFML  360
ELIWDDANAT PVLKFCSKIQ NPESQHKGRR TTTRAFETLC QPKVEAHESK RVTREPEEQE  420
GEKLAAMGPS YHTPTAKKSS SNKRKLQSTR ISDQVSNVRQ SIVDTLTTIK RFRTELETRE  480
ENLEAALVEI DGLGEKISGI TKILTK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1304318KKPGEITLLNKDGRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00602PBMTransfer from AT4G31610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412578.11e-145hypothetical protein EUTSA_v10024893mg
TrEMBLV4P3P11e-145V4P3P1_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.11e-135B3 family protein